SCOP 1.69: Domain d2vabb_: 2vab B:

Lineage for d2vabb_ (2vab B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (60 PDB entries)

8. Domain d2vabb_: 2vab B: [20788]
   Other proteins in same PDB: d2vaba1, d2vaba2

Details for d2vabb_

PDB Entry: 2vab, 2.5 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein

SCOP Domain Sequences for d2vabb_:

Sequence; same for both SEQRES and ATOM records:

>d2vabb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2vabb_:

• d2vabb_ first appeared (with stable ids) in SCOP 1.55, called d2vabb1
  
• d2vabb_ appears in SCOP 1.67
  
• d2vabb_ appears in SCOP 1.71
  
• d2vabb_ appears in the current release, SCOPe 2.08