Lineage for d2zn9a_ (2zn9 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269770Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1269771Protein automated matches [190513] (10 species)
    not a true protein
  7. 1269774Species Human (Homo sapiens) [TaxId:9606] [189519] (10 PDB entries)
  8. 1269791Domain d2zn9a_: 2zn9 A: [207879]
    automated match to d1juoa_
    complexed with 12p, 2pe, ca

Details for d2zn9a_

PDB Entry: 2zn9 (more details), 2.4 Å

PDB Description: Crystal structure of Ca2+-bound form of des3-20ALG-2
PDB Compounds: (A:) programmed cell death protein 6

SCOPe Domain Sequences for d2zn9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zn9a_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alpdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagv
nfseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdr
qgrgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfs

SCOPe Domain Coordinates for d2zn9a_:

Click to download the PDB-style file with coordinates for d2zn9a_.
(The format of our PDB-style files is described here.)

Timeline for d2zn9a_: