Lineage for d2zmwb_ (2zmw B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2548051Species Fungia concinna [TaxId:496660] [193728] (8 PDB entries)
  8. 2548063Domain d2zmwb_: 2zmw B: [207875]
    automated match to d2zmua_

Details for d2zmwb_

PDB Entry: 2zmw (more details), 2 Å

PDB Description: Crystal Structure of Monomeric Kusabira-Orange (MKO), Orange-Emitting GFP-like Protein, at pH 6.0
PDB Compounds: (B:) fluorescent protein

SCOPe Domain Sequences for d2zmwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zmwb_ d.22.1.0 (B:) automated matches {Fungia concinna [TaxId: 496660]}
vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs
hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks
kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk
aakkilkmpgshyishrlvrktegnitelvedavahs

SCOPe Domain Coordinates for d2zmwb_:

Click to download the PDB-style file with coordinates for d2zmwb_.
(The format of our PDB-style files is described here.)

Timeline for d2zmwb_: