SCOPe 2.05: Domain d2zmwb_: 2zmw B:

Lineage for d2zmwb_ (2zmw B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (20 species)
   not a true protein

7. Species Fungia concinna [TaxId:496660] [193728] (4 PDB entries)

8. Domain d2zmwb_: 2zmw B: [207875]
   automated match to d2zmua_

Details for d2zmwb_

PDB Entry: 2zmw, 2 Å

PDB Description: Crystal Structure of Monomeric Kusabira-Orange (MKO), Orange-Emitting GFP-like Protein, at pH 6.0

PDB Compounds: (B:) fluorescent protein

SCOPe Domain Sequences for d2zmwb_:

Sequence; same for both SEQRES and ATOM records:

>d2zmwb_ d.22.1.0 (B:) automated matches {Fungia concinna [TaxId: 496660]}
vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs
hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks
kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk
aakkilkmpgshyishrlvrktegnitelvedavahs

Timeline for d2zmwb_:

• d2zmwb_ first appeared in SCOPe 2.03
  
• d2zmwb_ appears in SCOPe 2.04
  
• d2zmwb_ appears in SCOPe 2.06
  
• d2zmwb_ appears in the current release, SCOPe 2.08