SCOPe 2.08: Domain d2zkhl2: 2zkh L:108-210

Lineage for d2zkhl2 (2zkh L:108-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d2zkhl2: 2zkh L:108-210 [207871]
   Other proteins in same PDB: d2zkhh1, d2zkhh2, d2zkhl1
   automated match to d1v7ml2

Details for d2zkhl2

PDB Entry: 2zkh, 2.04 Å

PDB Description: human thrombopoietin neutralizing antibody tn1 fab

PDB Compounds: (L:) Monoclonal TN1 Fab Light Chain

SCOPe Domain Sequences for d2zkhl2:

Sequence; same for both SEQRES and ATOM records:

>d2zkhl2 b.1.1.2 (L:108-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2zkhl2:

• d2zkhl2 first appeared in SCOPe 2.03
  
• d2zkhl2 appears in SCOPe 2.07