Lineage for d2zkhl1 (2zkh L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741215Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2741217Domain d2zkhl1: 2zkh L:1-107 [207870]
    Other proteins in same PDB: d2zkhh1, d2zkhh2, d2zkhl2
    automated match to d1v7ml1

Details for d2zkhl1

PDB Entry: 2zkh (more details), 2.04 Å

PDB Description: human thrombopoietin neutralizing antibody tn1 fab
PDB Compounds: (L:) Monoclonal TN1 Fab Light Chain

SCOPe Domain Sequences for d2zkhl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkhl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikr

SCOPe Domain Coordinates for d2zkhl1:

Click to download the PDB-style file with coordinates for d2zkhl1.
(The format of our PDB-style files is described here.)

Timeline for d2zkhl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zkhl2