Lineage for d2vaba1 (2vab A:182-274)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2747150Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
    Uniprot P01901 22-299
  8. 2747169Domain d2vaba1: 2vab A:182-274 [20787]
    Other proteins in same PDB: d2vaba2, d2vabb_

Details for d2vaba1

PDB Entry: 2vab (more details), 2.5 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
PDB Compounds: (A:) MHC class I h-2kb heavy chain

SCOPe Domain Sequences for d2vaba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaba1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOPe Domain Coordinates for d2vaba1:

Click to download the PDB-style file with coordinates for d2vaba1.
(The format of our PDB-style files is described here.)

Timeline for d2vaba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vaba2
View in 3D
Domains from other chains:
(mouse over for more information)
d2vabb_