Lineage for d2zkhh1 (2zkh H:1-116)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2352940Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2352990Domain d2zkhh1: 2zkh H:1-116 [207868]
    Other proteins in same PDB: d2zkhh2, d2zkhl1, d2zkhl2
    automated match to d1v7mh1

Details for d2zkhh1

PDB Entry: 2zkh (more details), 2.04 Å

PDB Description: human thrombopoietin neutralizing antibody tn1 fab
PDB Compounds: (H:) Monoclonal TN1 Fab Heavy Chain

SCOPe Domain Sequences for d2zkhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkhh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsa

SCOPe Domain Coordinates for d2zkhh1:

Click to download the PDB-style file with coordinates for d2zkhh1.
(The format of our PDB-style files is described here.)

Timeline for d2zkhh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zkhh2