SCOPe 2.07: Domain d2zjoa2: 2zjo A:326-630

Lineage for d2zjoa2 (2zjo A:326-630)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein automated matches [226986] (8 species)
   not a true protein

7. Species Hepatitis C virus (isolate taiwan) [TaxId:31645] [225628] (1 PDB entry)

8. Domain d2zjoa2: 2zjo A:326-630 [207867]
   Other proteins in same PDB: d2zjoa1
   automated match to d1heia2
   complexed with bht

Details for d2zjoa2

PDB Entry: 2zjo, 2.5 Å

PDB Description: Crystal structure of hepatitis C virus NS3 helicase with a novel inhibitor

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d2zjoa2:

Sequence; same for both SEQRES and ATOM records:

>d2zjoa2 c.37.1.14 (A:326-630) automated matches {Hepatitis C virus (isolate taiwan) [TaxId: 31645]}
pgsvtvphpnieeialsntgeipfygkaipietikggrhlifchskkkcdelaaklsalg
ihavayyrgldvsvipasgnvvvvatdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttmpqdavsrsqrrgrtsrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwkcltrlkptlhgptpllyrlgavqnevtlthpitkyimacmsa
dlevv

Timeline for d2zjoa2:

• d2zjoa2 first appeared in SCOPe 2.03
  
• d2zjoa2 appears in SCOPe 2.06
  
• d2zjoa2 appears in the current release, SCOPe 2.08