Lineage for d2zjoa2 (2zjo A:326-630)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1365362Family c.37.1.14: RNA helicase [52724] (4 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 1365439Protein automated matches [226986] (2 species)
    not a true protein
  7. 1365456Species Hepatitis c virus (isolate taiwan) [TaxId:31645] [225628] (1 PDB entry)
  8. 1365457Domain d2zjoa2: 2zjo A:326-630 [207867]
    Other proteins in same PDB: d2zjoa1
    automated match to d1heia2
    complexed with bht

Details for d2zjoa2

PDB Entry: 2zjo (more details), 2.5 Å

PDB Description: Crystal structure of hepatitis C virus NS3 helicase with a novel inhibitor
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d2zjoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjoa2 c.37.1.14 (A:326-630) automated matches {Hepatitis c virus (isolate taiwan) [TaxId: 31645]}
pgsvtvphpnieeialsntgeipfygkaipietikggrhlifchskkkcdelaaklsalg
ihavayyrgldvsvipasgnvvvvatdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttmpqdavsrsqrrgrtsrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwkcltrlkptlhgptpllyrlgavqnevtlthpitkyimacmsa
dlevv

SCOPe Domain Coordinates for d2zjoa2:

Click to download the PDB-style file with coordinates for d2zjoa2.
(The format of our PDB-style files is described here.)

Timeline for d2zjoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zjoa1