Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (4 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein automated matches [226986] (2 species) not a true protein |
Species Hepatitis c virus (isolate taiwan) [TaxId:31645] [225628] (1 PDB entry) |
Domain d2zjoa2: 2zjo A:326-630 [207867] Other proteins in same PDB: d2zjoa1 automated match to d1heia2 complexed with bht |
PDB Entry: 2zjo (more details), 2.5 Å
SCOPe Domain Sequences for d2zjoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjoa2 c.37.1.14 (A:326-630) automated matches {Hepatitis c virus (isolate taiwan) [TaxId: 31645]} pgsvtvphpnieeialsntgeipfygkaipietikggrhlifchskkkcdelaaklsalg ihavayyrgldvsvipasgnvvvvatdalmtgftgdfdsvidcntcvtqtvdfsldptft ietttmpqdavsrsqrrgrtsrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa tvcaraqapppswdqmwkcltrlkptlhgptpllyrlgavqnevtlthpitkyimacmsa dlevv
Timeline for d2zjoa2: