| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Hepatitis C virus (isolate taiwan) [TaxId:31645] [225627] (1 PDB entry) |
| Domain d2zjoa1: 2zjo A:187-325 [207866] Other proteins in same PDB: d2zjoa2 automated match to d1heia1 complexed with bht |
PDB Entry: 2zjo (more details), 2.5 Å
SCOPe Domain Sequences for d2zjoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjoa1 c.37.1.0 (A:187-325) automated matches {Hepatitis C virus (isolate taiwan) [TaxId: 31645]}
nssppavpqafqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
gvdpnirtgvrtittgapitystygkfladggcsggaydiimcdechstdsttilgigtv
ldqaetagarlvvlatatp
Timeline for d2zjoa1: