Lineage for d2zisb_ (2zis B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277123Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 1277124Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)
  7. 1277141Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (49 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 1277164Domain d2zisb_: 2zis B: [207863]
    Other proteins in same PDB: d2zisa_
    automated match to d2h6hb1
    complexed with acy, fpp, gol, nh8, zn

Details for d2zisb_

PDB Entry: 2zis (more details), 2.6 Å

PDB Description: Crystal Structure of rat protein farnesyltransferase complexed with a bezoruran inhibitor and FPP
PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d2zisb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zisb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpg

SCOPe Domain Coordinates for d2zisb_:

Click to download the PDB-style file with coordinates for d2zisb_.
(The format of our PDB-style files is described here.)

Timeline for d2zisb_: