SCOPe 2.05: Domain d2zirb_: 2zir B:

Lineage for d2zirb_ (2zir B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
   Uniprot Q02293 22-418 P53610

8. Domain d2zirb_: 2zir B: [207861]
   Other proteins in same PDB: d2zira_
   automated match to d2h6hb1
   complexed with fpp, gol, nh7, zn

Details for d2zirb_

PDB Entry: 2zir, 2.4 Å

PDB Description: Crystal Structure of rat protein farnesyltransferase complexed with a benzofuran inhibitor and FPP

PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d2zirb_:

Sequence; same for both SEQRES and ATOM records:

>d2zirb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggf
gggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevd
vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
ilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
mlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpg

Timeline for d2zirb_:

• d2zirb_ first appeared in SCOPe 2.03
  
• d2zirb_ appears in SCOPe 2.04
  
• d2zirb_ appears in SCOPe 2.06
  
• d2zirb_ appears in the current release, SCOPe 2.08