Lineage for d2zhzb_ (2zhz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705262Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2705281Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 2705282Protein automated matches [190652] (6 species)
    not a true protein
  7. 2705290Species Burkholderia thailandensis [TaxId:57975] [225495] (2 PDB entries)
  8. 2705292Domain d2zhzb_: 2zhz B: [207858]
    automated match to d2idxb_
    complexed with atp, gol, mg

Details for d2zhzb_

PDB Entry: 2zhz (more details), 1.8 Å

PDB Description: crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis
PDB Compounds: (B:) ATP:cob(I)alamin adenosyltransferase, putative

SCOPe Domain Sequences for d2zhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhzb_ a.25.2.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 57975]}
lskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvraalsa
iqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaalahvc
rtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvlwd

SCOPe Domain Coordinates for d2zhzb_:

Click to download the PDB-style file with coordinates for d2zhzb_.
(The format of our PDB-style files is described here.)

Timeline for d2zhzb_: