Lineage for d2ze0a1 (2ze0 A:2-471)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083946Species Geobacillus sp. [TaxId:258999] [225393] (1 PDB entry)
  8. 2083947Domain d2ze0a1: 2ze0 A:2-471 [207842]
    Other proteins in same PDB: d2ze0a2
    automated match to d1uoka2
    complexed with ca

Details for d2ze0a1

PDB Entry: 2ze0 (more details), 2 Å

PDB Description: Alpha-glucosidase GSJ
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d2ze0a1:

Sequence, based on SEQRES records: (download)

>d2ze0a1 c.1.8.0 (A:2-471) automated matches {Geobacillus sp. [TaxId: 258999]}
kktwwkegvayqiyprsfmdangdgigdlrgiiekldylvelgvdivwicpiyrspnadn
gydisdyyaimdefgtmddfdellaqahrrglkvildlvinhtsdehpwfiesrssrdnp
krdwyiwrdgkdgrepnnwesifggsawqydertgqyylhifdvkqpdlnwensevrqal
yemvnwwldkgidgfridaishikkkpglpdlpnpkglkyvpsfaghmnqpgimeylrel
keqtfarydimtvgeangvtvdeaeqwvgeengvfnmifqfehlglwerradgsidvrrl
krtltkwqkglenrgwnalflenhdlprsvstwgndrdywaesakalgalyffmqgtpfi
yqgqeigmtnvrfddirdyrdvsalrlyelerakgrtheeamtiiwktgrdnsrtpmqws
gasnagfttgtpwikvnenyrtinveaerrdpnsvwsfyrqmiqlrkanelfvy

Sequence, based on observed residues (ATOM records): (download)

>d2ze0a1 c.1.8.0 (A:2-471) automated matches {Geobacillus sp. [TaxId: 258999]}
kktwwkegvayqiyprsfmdangdgigdlrgiiekldylvelgvdivwicpiyrspnadn
gydisdyyaimdefgtmddfdellaqahrrglkvildlvinhtsdehpwfiesrssrdnp
krdwyiwrdgkdgrepnnwesifggsawqydertgqyylhifdvkqpdlnwensevrqal
yemvnwwldkgidgfridaishikkkpglpdlplkyvpsfaghmnqpgimeylrelkeqt
farydimtvgeangvtvdeaeqwvgeengvfnmifqfehlglwerrasidvrrlkrtltk
wqkglenrgwnalflenhdlprsvstwgndrdywaesakalgalyffmqgtpfiyqgqei
gmtnvrfddirdyrdvsalriiwktgrdnsrtpmqwsgasnagfttgtpwikvnenyrti
nveaerrdpnsvwsfyrqmiqlrkanelfvy

SCOPe Domain Coordinates for d2ze0a1:

Click to download the PDB-style file with coordinates for d2ze0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ze0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ze0a2