Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (39 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [226603] (4 PDB entries) |
Domain d2zdqb1: 2zdq B:1-114 [207840] Other proteins in same PDB: d2zdqa2, d2zdqb2 automated match to d1e4ea1 complexed with atp, dal |
PDB Entry: 2zdq (more details), 2.3 Å
SCOPe Domain Sequences for d2zdqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zdqb1 c.30.1.0 (B:1-114) automated matches {Thermus thermophilus [TaxId: 274]} mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm
Timeline for d2zdqb1: