SCOPe 2.07: Domain d2zdqb1: 2zdq B:1-114

Lineage for d2zdqb1 (2zdq B:1-114)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (39 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [226603] (4 PDB entries)

8. Domain d2zdqb1: 2zdq B:1-114 [207840]
   Other proteins in same PDB: d2zdqa2, d2zdqb2
   automated match to d1e4ea1
   complexed with atp, dal

Details for d2zdqb1

PDB Entry: 2zdq, 2.3 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdqb1:

Sequence; same for both SEQRES and ATOM records:

>d2zdqb1 c.30.1.0 (B:1-114) automated matches {Thermus thermophilus [TaxId: 274]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

Timeline for d2zdqb1:

• d2zdqb1 first appeared in SCOPe 2.03
  
• d2zdqb1 appears in SCOPe 2.06
  
• d2zdqb1 appears in the current release, SCOPe 2.08