SCOPe 2.06: Domain d2zdqa2: 2zdq A:115-319

Lineage for d2zdqa2 (2zdq A:115-319)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (32 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225373] (6 PDB entries)

8. Domain d2zdqa2: 2zdq A:115-319 [207839]
   Other proteins in same PDB: d2zdqa1, d2zdqb1
   automated match to d1e4ea2
   complexed with atp, dal

Details for d2zdqa2

PDB Entry: 2zdq, 2.3 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdqa2:

Sequence; same for both SEQRES and ATOM records:

>d2zdqa2 d.142.1.0 (A:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Timeline for d2zdqa2:

• d2zdqa2 first appeared in SCOPe 2.03
  
• d2zdqa2 appears in SCOPe 2.05
  
• d2zdqa2 appears in SCOPe 2.07
  
• d2zdqa2 appears in the current release, SCOPe 2.08