Lineage for d2zdqa1 (2zdq A:1-114)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862499Species Thermus thermophilus [TaxId:274] [226603] (4 PDB entries)
  8. 2862510Domain d2zdqa1: 2zdq A:1-114 [207838]
    Other proteins in same PDB: d2zdqa2, d2zdqb2
    automated match to d1e4ea1
    complexed with atp, dal

Details for d2zdqa1

PDB Entry: 2zdq (more details), 2.3 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zdqa1 c.30.1.0 (A:1-114) automated matches {Thermus thermophilus [TaxId: 274]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

SCOPe Domain Coordinates for d2zdqa1:

Click to download the PDB-style file with coordinates for d2zdqa1.
(The format of our PDB-style files is described here.)

Timeline for d2zdqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zdqa2