Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (18 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [225373] (6 PDB entries) |
Domain d2zdhd2: 2zdh D:115-319 [207837] Other proteins in same PDB: d2zdha1, d2zdhb1, d2zdhc1, d2zdhd1 automated match to d1e4ea2 complexed with adp, dal, mg |
PDB Entry: 2zdh (more details), 1.9 Å
SCOPe Domain Sequences for d2zdhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zdhd2 d.142.1.0 (D:115-319) automated matches {Thermus thermophilus [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm yprlfeaggvaypellrrlvelalt
Timeline for d2zdhd2: