SCOPe 2.08: Domain d2zdhd2: 2zdh D:115-319

Lineage for d2zdhd2 (2zdh D:115-319)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [346384] (13 PDB entries)

8. Domain d2zdhd2: 2zdh D:115-319 [207837]
   Other proteins in same PDB: d2zdha1, d2zdhb1, d2zdhc1, d2zdhd1
   automated match to d1e4ea2
   complexed with adp, dal, mg

Details for d2zdhd2

PDB Entry: 2zdh, 1.9 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ADP and D-Alanine from Thermus thermophius HB8

PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdhd2:

Sequence; same for both SEQRES and ATOM records:

>d2zdhd2 d.142.1.0 (D:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Timeline for d2zdhd2:

• d2zdhd2 first appeared in SCOPe 2.03
  
• d2zdhd2 appears in SCOPe 2.07