SCOP 1.67: Domain d1a6zc1: 1a6z C:182-275

Lineage for d1a6zc1 (1a6z C:182-275)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Hemochromatosis protein Hfe, alpha-3 domain [88608] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88609] (2 PDB entries)

8. Domain d1a6zc1: 1a6z C:182-275 [20783]
   Other proteins in same PDB: d1a6za2, d1a6zb_, d1a6zc2, d1a6zd_

Details for d1a6zc1

PDB Entry: 1a6z, 2.6 Å

PDB Description: hfe (human) hemochromatosis protein

SCOP Domain Sequences for d1a6zc1:

Sequence; same for both SEQRES and ATOM records:

>d1a6zc1 b.1.1.2 (C:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens)}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw

Timeline for d1a6zc1:

• d1a6zc1 first appeared (with stable ids) in SCOP 1.55
  
• d1a6zc1 appears in SCOP 1.65
  
• d1a6zc1 appears in SCOP 1.69
  
• d1a6zc1 appears in the current release, SCOPe 2.08