SCOPe 2.08: Domain d2zdgb2: 2zdg B:115-319

Lineage for d2zdgb2 (2zdg B:115-319)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [346384] (13 PDB entries)

8. Domain d2zdgb2: 2zdg B:115-319 [207825]
   Other proteins in same PDB: d2zdga1, d2zdgb1, d2zdgc1, d2zdgd1
   automated match to d1e4ea2
   complexed with adp, mg

Details for d2zdgb2

PDB Entry: 2zdg, 2.2 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ADP from Thermus thermophius HB8

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdgb2:

Sequence, based on SEQRES records:

>d2zdgb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Sequence, based on observed residues (ATOM records):

>d2zdgb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeaellipapldtqetv
qelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggvaypell
rrlvelalt

Timeline for d2zdgb2:

• d2zdgb2 first appeared in SCOPe 2.03
  
• d2zdgb2 appears in SCOPe 2.07