Lineage for d2zdgb1 (2zdg B:1-114)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360440Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1360441Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1360707Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1360708Protein automated matches [226903] (19 species)
    not a true protein
  7. 1360759Species Thermus thermophilus [TaxId:274] [226819] (3 PDB entries)
  8. 1360765Domain d2zdgb1: 2zdg B:1-114 [207824]
    Other proteins in same PDB: d2zdga2, d2zdgb2, d2zdgc2, d2zdgd2
    automated match to d1e4ea1
    complexed with adp, mg

Details for d2zdgb1

PDB Entry: 2zdg (more details), 2.2 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ADP from Thermus thermophius HB8
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zdgb1 c.30.1.0 (B:1-114) automated matches {Thermus thermophilus}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

SCOPe Domain Coordinates for d2zdgb1:

Click to download the PDB-style file with coordinates for d2zdgb1.
(The format of our PDB-style files is described here.)

Timeline for d2zdgb1: