![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.91: PEP carboxykinase-like [53794] (1 superfamily) contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side |
![]() | Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) ![]() |
![]() | Family c.91.1.0: automated matches [196141] (1 protein) not a true family |
![]() | Protein automated matches [196142] (6 species) not a true protein |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [225442] (1 PDB entry) |
![]() | Domain d2zcic2: 2zci C:246-606 [207819] Other proteins in same PDB: d2zcia1, d2zcib1, d2zcic1, d2zcid1 automated match to d1khba1 |
PDB Entry: 2zci (more details), 2.3 Å
SCOPe Domain Sequences for d2zcic2:
Sequence, based on SEQRES records: (download)
>d2zcic2 c.91.1.0 (C:246-606) automated matches {Corynebacterium glutamicum [TaxId: 1718]} wmaehmlilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiawlklre dglyavnpengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmdgdapa hlidwmgndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggrradtv plvtqtydwehgtmvgallasgqtaasaeakvgtlrhdpmamlpfigynageylqnwidm gnkggdkmpsiflvnwfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvvghtak aedldldgldtpiedvkealtapaeqwandvednaeyltflgprvpaevhsqfdalkari s
>d2zcic2 c.91.1.0 (C:246-606) automated matches {Corynebacterium glutamicum [TaxId: 1718]} wmaehmlilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiawlklre dglyavnpengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmdgdapa hlidwmgndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggrradtv plvtqtydwehgtmvgallasgqvgtlrhdpmamlpfigynageylqnwidmgnkggdkm psiflvnwfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvvghtakaedldldg ldtpiedvkealtapaeqwandvednaeyltflgprvpaevhsqfdalkaris
Timeline for d2zcic2: