Lineage for d2zcib2 (2zci B:246-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143188Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2143189Protein automated matches [196142] (6 species)
    not a true protein
  7. 2143206Species Corynebacterium glutamicum [TaxId:1718] [225442] (1 PDB entry)
  8. 2143208Domain d2zcib2: 2zci B:246-606 [207817]
    Other proteins in same PDB: d2zcia1, d2zcib1, d2zcic1, d2zcid1
    automated match to d1khba1

Details for d2zcib2

PDB Entry: 2zci (more details), 2.3 Å

PDB Description: Structure of a GTP-dependent bacterial PEP-carboxykinase from Corynebacterium glutamicum
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d2zcib2:

Sequence, based on SEQRES records: (download)

>d2zcib2 c.91.1.0 (B:246-606) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
wmaehmlilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiawlklre
dglyavnpengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmdgdapa
hlidwmgndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggrradtv
plvtqtydwehgtmvgallasgqtaasaeakvgtlrhdpmamlpfigynageylqnwidm
gnkggdkmpsiflvnwfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvvghtak
aedldldgldtpiedvkealtapaeqwandvednaeyltflgprvpaevhsqfdalkari
s

Sequence, based on observed residues (ATOM records): (download)

>d2zcib2 c.91.1.0 (B:246-606) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
wmaehmlilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiawlklre
dglyavnpengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmdgdapa
hlidwmgndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggrradtv
plvtqtydwehgtmvgallasggtlrhdpmamlpfigynageylqnwidmgnkggdkmps
iflvnwfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvvghtakaedldldgld
tpiedvkealtapaeqwandvednaeyltflgprvpaevhsqfdalkaris

SCOPe Domain Coordinates for d2zcib2:

Click to download the PDB-style file with coordinates for d2zcib2.
(The format of our PDB-style files is described here.)

Timeline for d2zcib2: