Lineage for d2zcib1 (2zci B:13-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920813Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 2920814Protein automated matches [226847] (5 species)
    not a true protein
  7. 2920831Species Corynebacterium glutamicum [TaxId:1718] [225441] (1 PDB entry)
  8. 2920833Domain d2zcib1: 2zci B:13-245 [207816]
    Other proteins in same PDB: d2zcia2, d2zcib2, d2zcic2, d2zcid2
    automated match to d1khba2

Details for d2zcib1

PDB Entry: 2zci (more details), 2.3 Å

PDB Description: Structure of a GTP-dependent bacterial PEP-carboxykinase from Corynebacterium glutamicum
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d2zcib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zcib1 c.109.1.0 (B:13-245) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
aptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtliklneekrpnsyl
arsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyagsmkgrtmyvvpfc
mgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrclhsvgaplepgq
edvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvmareeg

SCOPe Domain Coordinates for d2zcib1:

Click to download the PDB-style file with coordinates for d2zcib1.
(The format of our PDB-style files is described here.)

Timeline for d2zcib1: