![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.0: automated matches [227144] (1 protein) not a true family |
![]() | Protein automated matches [226847] (5 species) not a true protein |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [225441] (1 PDB entry) |
![]() | Domain d2zcib1: 2zci B:13-245 [207816] Other proteins in same PDB: d2zcia2, d2zcib2, d2zcic2, d2zcid2 automated match to d1khba2 |
PDB Entry: 2zci (more details), 2.3 Å
SCOPe Domain Sequences for d2zcib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcib1 c.109.1.0 (B:13-245) automated matches {Corynebacterium glutamicum [TaxId: 1718]} aptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtliklneekrpnsyl arsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyagsmkgrtmyvvpfc mgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrclhsvgaplepgq edvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvmareeg
Timeline for d2zcib1: