SCOPe 2.04: Domain d2zcia1: 2zci A:13-245

Lineage for d2zcia1 (2zci A:13-245)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (4 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [225441] (1 PDB entry)

8. Domain d2zcia1: 2zci A:13-245 [207814]
   Other proteins in same PDB: d2zcia2, d2zcib2, d2zcic2, d2zcid2
   automated match to d1khba2

Details for d2zcia1

PDB Entry: 2zci, 2.3 Å

PDB Description: Structure of a GTP-dependent bacterial PEP-carboxykinase from Corynebacterium glutamicum

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d2zcia1:

Sequence; same for both SEQRES and ATOM records:

>d2zcia1 c.109.1.0 (A:13-245) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
aptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtliklneekrpnsyl
arsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyagsmkgrtmyvvpfc
mgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrclhsvgaplepgq
edvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvmareeg

Timeline for d2zcia1:

• d2zcia1 first appeared in SCOPe 2.03
  
• d2zcia1 appears in SCOPe 2.05
  
• d2zcia1 appears in the current release, SCOPe 2.08