Lineage for d2zc8a2 (2zc8 A:126-368)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837865Species Thermus thermophilus HB8 [TaxId:300852] [225416] (1 PDB entry)
  8. 2837866Domain d2zc8a2: 2zc8 A:126-368 [207811]
    Other proteins in same PDB: d2zc8a1, d2zc8b1
    automated match to d1wuea1

Details for d2zc8a2

PDB Entry: 2zc8 (more details), 1.95 Å

PDB Description: Crystal structure of N-Acylamino Acid Racemase from Thermus thermophilus HB8
PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d2zc8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zc8a2 c.1.11.0 (A:126-368) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
vrqavevgvslgiqpsvedtlrvverhleegyrriklkikpgwdyevlkavreafpeatl
tadansayslanlaqlkrldelrldyieqplayddlldhaklqrelstpicldesltgae
karkaielgagrvfnvkparlgghgeslrvhalaesagiplwmggmleagvgrahnlhla
tlpgftkpgdvssasryweediveealeakdglmpvpegvgigvhlklpfvervtlwqry
msa

SCOPe Domain Coordinates for d2zc8a2:

Click to download the PDB-style file with coordinates for d2zc8a2.
(The format of our PDB-style files is described here.)

Timeline for d2zc8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zc8a1