Lineage for d2zc8a1 (2zc8 A:1-125)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905907Species Thermus thermophilus HB8 [TaxId:300852] [225415] (1 PDB entry)
  8. 1905908Domain d2zc8a1: 2zc8 A:1-125 [207810]
    Other proteins in same PDB: d2zc8a2, d2zc8b2
    automated match to d1wuea2

Details for d2zc8a1

PDB Entry: 2zc8 (more details), 1.95 Å

PDB Description: Crystal structure of N-Acylamino Acid Racemase from Thermus thermophilus HB8
PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d2zc8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zc8a1 d.54.1.0 (A:1-125) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrieaaelrilelplkfrfetsfgvqtkrtilllrlfgegleglgegvmerlplyreetv
agarylleevflprvlgrdlpnpealrealapfrgnpmakavlemaffdlwakalgrplw
qvlgg

SCOPe Domain Coordinates for d2zc8a1:

Click to download the PDB-style file with coordinates for d2zc8a1.
(The format of our PDB-style files is described here.)

Timeline for d2zc8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zc8a2