Lineage for d2zatc_ (2zat C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847997Species Pig (Sus scrofa) [TaxId:9823] [225450] (1 PDB entry)
  8. 2848000Domain d2zatc_: 2zat C: [207806]
    automated match to d1zema1
    complexed with nap

Details for d2zatc_

PDB Entry: 2zat (more details), 1.5 Å

PDB Description: Crystal structure of a mammalian reductase
PDB Compounds: (C:) Dehydrogenase/reductase SDR family member 4

SCOPe Domain Sequences for d2zatc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zatc_ c.2.1.0 (C:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
kplenkvalvtastdgiglaiarrlaqdgahvvvssrkqenvdrtvatlqgeglsvtgtv
chvgkaedrerlvamavnlhggvdilvsnaavnpffgniidateevwdkilhvnvkatvl
mtkavvpemekrgggsvlivssvgayhpfpnlgpynvsktallgltknlavelaprnirv
nclapgliktnfsqvlwmdkarkeymkeslrirrlgnpedcagivsflcsedasyitget
vvvgggtasrl

SCOPe Domain Coordinates for d2zatc_:

Click to download the PDB-style file with coordinates for d2zatc_.
(The format of our PDB-style files is described here.)

Timeline for d2zatc_: