Lineage for d2zata_ (2zat A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095582Species Pig (Sus scrofa) [TaxId:9823] [225450] (1 PDB entry)
  8. 2095583Domain d2zata_: 2zat A: [207804]
    automated match to d1zema1
    complexed with nap

Details for d2zata_

PDB Entry: 2zat (more details), 1.5 Å

PDB Description: Crystal structure of a mammalian reductase
PDB Compounds: (A:) Dehydrogenase/reductase SDR family member 4

SCOPe Domain Sequences for d2zata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zata_ c.2.1.0 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
kplenkvalvtastdgiglaiarrlaqdgahvvvssrkqenvdrtvatlqgeglsvtgtv
chvgkaedrerlvamavnlhggvdilvsnaavnpffgniidateevwdkilhvnvkatvl
mtkavvpemekrgggsvlivssvgayhpfpnlgpynvsktallgltknlavelaprnirv
nclapgliktnfsqvlwmdkarkeymkeslrirrlgnpedcagivsflcsedasyitget
vvvgggtasrl

SCOPe Domain Coordinates for d2zata_:

Click to download the PDB-style file with coordinates for d2zata_.
(The format of our PDB-style files is described here.)

Timeline for d2zata_: