SCOPe 2.08: Domain d2zadd1: 2zad D:2-124

Lineage for d2zadd1 (2zad D:2-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries)

8. Domain d2zadd1: 2zad D:2-124 [207802]
   Other proteins in same PDB: d2zada2, d2zadb2, d2zadc2, d2zadd2
   automated match to d1jpma2
   complexed with 1pe, mn, peg

Details for d2zadd1

PDB Entry: 2zad, 1.6 Å

PDB Description: Crystal Structure of Muconate Cycloisomerase from Thermotoga maritima MSB8

PDB Compounds: (D:) Muconate cycloisomerase

SCOPe Domain Sequences for d2zadd1:

Sequence; same for both SEQRES and ATOM records:

>d2zadd1 d.54.1.0 (D:2-124) automated matches {Thermotoga maritima [TaxId: 243274]}
srivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerve
allaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyl
lgg

Timeline for d2zadd1:

• d2zadd1 first appeared in SCOPe 2.03
  
• d2zadd1 appears in SCOPe 2.07