SCOPe 2.08: Domain d2zadb2: 2zad B:125-345

Lineage for d2zadb2 (2zad B:125-345)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries)

8. Domain d2zadb2: 2zad B:125-345 [207799]
   Other proteins in same PDB: d2zada1, d2zadb1, d2zadc1, d2zadd1
   automated match to d1jpma1
   complexed with 1pe, mn, peg

Details for d2zadb2

PDB Entry: 2zad, 1.6 Å

PDB Description: Crystal Structure of Muconate Cycloisomerase from Thermotoga maritima MSB8

PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d2zadb2:

Sequence; same for both SEQRES and ATOM records:

>d2zadb2 c.1.11.0 (B:125-345) automated matches {Thermotoga maritima [TaxId: 243274]}
krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak
yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa
rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv
hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq

Timeline for d2zadb2:

• d2zadb2 first appeared in SCOPe 2.03
  
• d2zadb2 appears in SCOPe 2.07