Lineage for d2zadb1 (2zad B:2-124)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413299Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries)
  8. 1413301Domain d2zadb1: 2zad B:2-124 [207798]
    Other proteins in same PDB: d2zada2, d2zadb2, d2zadc2, d2zadd2
    automated match to d1jpma2
    complexed with 1pe, mn, peg

Details for d2zadb1

PDB Entry: 2zad (more details), 1.6 Å

PDB Description: Crystal Structure of Muconate Cycloisomerase from Thermotoga maritima MSB8
PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d2zadb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zadb1 d.54.1.0 (B:2-124) automated matches {Thermotoga maritima [TaxId: 243274]}
srivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerve
allaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyl
lgg

SCOPe Domain Coordinates for d2zadb1:

Click to download the PDB-style file with coordinates for d2zadb1.
(The format of our PDB-style files is described here.)

Timeline for d2zadb1: