![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (79 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries) |
![]() | Domain d2zada2: 2zad A:125-345 [207797] Other proteins in same PDB: d2zada1, d2zadb1, d2zadc1, d2zadd1 automated match to d1jpma1 complexed with 1pe, mn, peg |
PDB Entry: 2zad (more details), 1.6 Å
SCOPe Domain Sequences for d2zada2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zada2 c.1.11.0 (A:125-345) automated matches {Thermotoga maritima [TaxId: 243274]} krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
Timeline for d2zada2: