Lineage for d1de4g1 (1de4 G:182-275)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364980Protein Hemochromatosis protein Hfe, alpha-3 domain [88608] (1 species)
  7. 364981Species Human (Homo sapiens) [TaxId:9606] [88609] (2 PDB entries)
  8. 364984Domain d1de4g1: 1de4 G:182-275 [20779]
    Other proteins in same PDB: d1de4a2, d1de4b_, d1de4c1, d1de4c2, d1de4c3, d1de4d2, d1de4e_, d1de4f1, d1de4f2, d1de4f3, d1de4g2, d1de4h_, d1de4i1, d1de4i2, d1de4i3

Details for d1de4g1

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor

SCOP Domain Sequences for d1de4g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4g1 b.1.1.2 (G:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens)}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw

SCOP Domain Coordinates for d1de4g1:

Click to download the PDB-style file with coordinates for d1de4g1.
(The format of our PDB-style files is described here.)

Timeline for d1de4g1: