Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (21 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225384] (1 PDB entry) |
Domain d2z9sb_: 2z9s B: [207787] automated match to d1uula_ mutant |
PDB Entry: 2z9s (more details), 2.9 Å
SCOPe Domain Sequences for d2z9sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z9sb_ c.47.1.10 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} sgnakighpapsfkatavmpdgqfkdislsdykgkyvvfffypldftfvspteiiafsdr aeefkklncqvigasvdshfchlawintpkkqgglgpmniplvsdpkrtiaqdygvlkad egisfrglfiiddkgilrqitindlpvgrsvdeilrlvqafqftdkhgevcpagwkpgsd tikpdvnkskeyfskqk
Timeline for d2z9sb_: