Lineage for d2z9sa_ (2z9s A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853871Protein automated matches [190100] (17 species)
    not a true protein
  7. 1854146Species Norway rat (Rattus norvegicus) [TaxId:10116] [225384] (1 PDB entry)
  8. 1854147Domain d2z9sa_: 2z9s A: [207786]
    automated match to d1uula_
    mutant

Details for d2z9sa_

PDB Entry: 2z9s (more details), 2.9 Å

PDB Description: crystal structure analysis of rat hbp23/peroxiredoxin i, cys52ser mutant
PDB Compounds: (A:) Peroxiredoxin-1

SCOPe Domain Sequences for d2z9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z9sa_ c.47.1.10 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgnakighpapsfkatavmpdgqfkdislsdykgkyvvfffypldftfvspteiiafsdr
aeefkklncqvigasvdshfchlawintpkkqgglgpmniplvsdpkrtiaqdygvlkad
egisfrglfiiddkgilrqitindlpvgrsvdeilrlvqafqftdkhgevcpagwkpgsd
tikpdvnkskeyfskqk

SCOPe Domain Coordinates for d2z9sa_:

Click to download the PDB-style file with coordinates for d2z9sa_.
(The format of our PDB-style files is described here.)

Timeline for d2z9sa_: