SCOPe 2.04: Domain d2z79b_: 2z79 B:

Lineage for d2z79b_ (2z79 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (9 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225389] (2 PDB entries)

8. Domain d2z79b_: 2z79 B: [207780]
   automated match to d2b42b_
   complexed with gol

Details for d2z79b_

PDB Entry: 2z79, 1.3 Å

PDB Description: high resolution crystal structure of a glycoside hydrolase family 11 xylanase of bacillus subtilis

PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2z79b_:

Sequence; same for both SEQRES and ATOM records:

>d2z79b_ b.29.1.11 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmatagyqssgssn
vtvw

Timeline for d2z79b_:

• d2z79b_ first appeared in SCOPe 2.03
  
• d2z79b_ appears in SCOPe 2.05
  
• d2z79b_ appears in the current release, SCOPe 2.08