Lineage for d2z79b_ (2z79 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780274Species Bacillus subtilis [TaxId:1423] [225389] (2 PDB entries)
  8. 2780276Domain d2z79b_: 2z79 B: [207780]
    automated match to d2b42b_
    complexed with gol

Details for d2z79b_

PDB Entry: 2z79 (more details), 1.3 Å

PDB Description: high resolution crystal structure of a glycoside hydrolase family 11 xylanase of bacillus subtilis
PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2z79b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z79b_ b.29.1.11 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmatagyqssgssn
vtvw

SCOPe Domain Coordinates for d2z79b_:

Click to download the PDB-style file with coordinates for d2z79b_.
(The format of our PDB-style files is described here.)

Timeline for d2z79b_: