| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein automated matches [190135] (18 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [225389] (2 PDB entries) |
| Domain d2z79a_: 2z79 A: [207779] automated match to d2b42b_ complexed with gol |
PDB Entry: 2z79 (more details), 1.3 Å
SCOPe Domain Sequences for d2z79a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z79a_ b.29.1.11 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmatagyqssgssn
vtvw
Timeline for d2z79a_: