SCOPe 2.08: Domain d2z79a_: 2z79 A:

Lineage for d2z79a_ (2z79 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (18 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225389] (2 PDB entries)

8. Domain d2z79a_: 2z79 A: [207779]
   automated match to d2b42b_
   complexed with gol

Details for d2z79a_

PDB Entry: 2z79, 1.3 Å

PDB Description: high resolution crystal structure of a glycoside hydrolase family 11 xylanase of bacillus subtilis

PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2z79a_:

Sequence; same for both SEQRES and ATOM records:

>d2z79a_ b.29.1.11 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmatagyqssgssn
vtvw

Timeline for d2z79a_:

• d2z79a_ first appeared in SCOPe 2.03
  
• d2z79a_ appears in SCOPe 2.07