Lineage for d2z43c2 (2z43 C:73-323)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869714Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 2869770Species Sulfolobus solfataricus [TaxId:273057] [225378] (1 PDB entry)
  8. 2869773Domain d2z43c2: 2z43 C:73-323 [207772]
    Other proteins in same PDB: d2z43b1, d2z43c1
    automated match to d1pzna2

Details for d2z43c2

PDB Entry: 2z43 (more details), 1.93 Å

PDB Description: Structure of a twinned crystal of RadA
PDB Compounds: (C:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d2z43c2:

Sequence, based on SEQRES records: (download)

>d2z43c2 c.37.1.11 (C:73-323) DNA repair protein Rad51, catalytic domain {Sulfolobus solfataricus [TaxId: 273057]}
fktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnvq
lppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaivd
dlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiavi
itnqvmarpdmfygdptvavgghtlyhvpgiriqlkksrgnrriarvvdaphlpegevvf
alteegirdae

Sequence, based on observed residues (ATOM records): (download)

>d2z43c2 c.37.1.11 (C:73-323) DNA repair protein Rad51, catalytic domain {Sulfolobus solfataricus [TaxId: 273057]}
fktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnvq
lppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaivd
dlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiavi
itnqvpgiriqlkksrgnrriarvvdaphlpegevvfalteegirdae

SCOPe Domain Coordinates for d2z43c2:

Click to download the PDB-style file with coordinates for d2z43c2.
(The format of our PDB-style files is described here.)

Timeline for d2z43c2: