Lineage for d1de4d1 (1de4 D:182-275)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747618Protein Hemochromatosis protein Hfe, alpha-3 domain [88608] (1 species)
  7. 2747619Species Human (Homo sapiens) [TaxId:9606] [88609] (2 PDB entries)
  8. 2747623Domain d1de4d1: 1de4 D:182-275 [20777]
    Other proteins in same PDB: d1de4a2, d1de4b_, d1de4c1, d1de4c2, d1de4c3, d1de4d2, d1de4e_, d1de4f1, d1de4f2, d1de4f3, d1de4g2, d1de4h_, d1de4i1, d1de4i2, d1de4i3
    complexed with ca, gol, nag

Details for d1de4d1

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor
PDB Compounds: (D:) hemochromatosis protein

SCOPe Domain Sequences for d1de4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4d1 b.1.1.2 (D:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw

SCOPe Domain Coordinates for d1de4d1:

Click to download the PDB-style file with coordinates for d1de4d1.
(The format of our PDB-style files is described here.)

Timeline for d1de4d1: