SCOPe 2.08: Domain d2z43b1: 2z43 B:12-72

Lineage for d2z43b1 (2z43 B:12-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)

6. Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)

7. Species Sulfolobus solfataricus [TaxId:273057] [225377] (1 PDB entry)

8. Domain d2z43b1: 2z43 B:12-72 [207769]
   Other proteins in same PDB: d2z43a_, d2z43b2, d2z43c2
   automated match to d1pzna1

Details for d2z43b1

PDB Entry: 2z43, 1.93 Å

PDB Description: Structure of a twinned crystal of RadA

PDB Compounds: (B:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d2z43b1:

Sequence; same for both SEQRES and ATOM records:

>d2z43b1 a.60.4.1 (B:12-72) DNA repair protein Rad51, N-terminal domain {Sulfolobus solfataricus [TaxId: 273057]}
ktindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqkiikeardaldi
r

Timeline for d2z43b1:

• d2z43b1 first appeared in SCOPe 2.03
  
• d2z43b1 appears in SCOPe 2.07