Lineage for d2z43b1 (2z43 B:12-72)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715792Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715793Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 2715794Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)
  7. 2715825Species Sulfolobus solfataricus [TaxId:273057] [225377] (1 PDB entry)
  8. 2715826Domain d2z43b1: 2z43 B:12-72 [207769]
    Other proteins in same PDB: d2z43a_, d2z43b2, d2z43c2
    automated match to d1pzna1

Details for d2z43b1

PDB Entry: 2z43 (more details), 1.93 Å

PDB Description: Structure of a twinned crystal of RadA
PDB Compounds: (B:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d2z43b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z43b1 a.60.4.1 (B:12-72) DNA repair protein Rad51, N-terminal domain {Sulfolobus solfataricus [TaxId: 273057]}
ktindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqkiikeardaldi
r

SCOPe Domain Coordinates for d2z43b1:

Click to download the PDB-style file with coordinates for d2z43b1.
(The format of our PDB-style files is described here.)

Timeline for d2z43b1: