Lineage for d2z2jb_ (2z2j B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142123Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2142137Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2142138Protein automated matches [193326] (10 species)
    not a true protein
  7. 2142167Species Mycobacterium tuberculosis [TaxId:83332] [225299] (7 PDB entries)
  8. 2142172Domain d2z2jb_: 2z2j B: [207767]
    automated match to d4jy7a_

Details for d2z2jb_

PDB Entry: 2z2j (more details), 2.35 Å

PDB Description: Crystal structure of Peptidyl-tRNA hydrolase from Mycobacterium tuberculosis
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2z2jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z2jb_ c.56.3.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
maepllvvglgnpganyartrhnlgfvvadllaarlgakfkahkrsgaevatgrsagrsl
vlakprcymnesgrqigplakfysvapaniivihddldlefgrirlkigggegghnglrs
vvaalgtkdfqrvrigigrppgrkdpaafvlenftpaeraevpticeqaadatellieqg
me

SCOPe Domain Coordinates for d2z2jb_:

Click to download the PDB-style file with coordinates for d2z2jb_.
(The format of our PDB-style files is described here.)

Timeline for d2z2jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2z2ja_