Lineage for d2z2ia_ (2z2i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889344Species Mycobacterium tuberculosis [TaxId:83332] [225299] (7 PDB entries)
  8. 2889345Domain d2z2ia_: 2z2i A: [207765]
    automated match to d4jy7a_

Details for d2z2ia_

PDB Entry: 2z2i (more details), 1.98 Å

PDB Description: Crystal structure of Peptidyl-tRNA hydrolase from Mycobacterium tuberculosis
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2z2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z2ia_ c.56.3.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
maepllvvglgnpganyartrhnlgfvvadllaarlgakfkahkrsgaevatgrsagrsl
vlakprcymnesgrqigplakfysvapaniivihddldlefgrirlkigggegghnglrs
vvaalgtkdfqrvrigigrppgrkdpaafvlenftpaeraevpticeqaadatellieq

SCOPe Domain Coordinates for d2z2ia_:

Click to download the PDB-style file with coordinates for d2z2ia_.
(The format of our PDB-style files is described here.)

Timeline for d2z2ia_: