SCOPe 2.08: Domain d2z0ma2: 2z0m A:193-331

Lineage for d2z0ma2 (2z0m A:193-331)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:111955] [225376] (1 PDB entry)

8. Domain d2z0ma2: 2z0m A:193-331 [207764]
   automated match to d1hv8a2

Details for d2z0ma2

PDB Entry: 2z0m, 1.9 Å

PDB Description: Crystal structure of hypothetical ATP-dependent RNA helicase from Sulfolobus tokodaii

PDB Compounds: (A:) 337aa long hypothetical ATP-dependent RNA helicase deaD

SCOPe Domain Sequences for d2z0ma2:

Sequence; same for both SEQRES and ATOM records:

>d2z0ma2 c.37.1.0 (A:193-331) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
glanvehkfvhvkddwrskvqalrenkdkgvivfvrtrnrvaklvrlfdnaielrgdlpq
svrnrnidafregeydmlittdvasrgldiplvekvinfdapqdlrtyihrigrtgrmgr
kgeaitfilneywlekevk

Timeline for d2z0ma2:

• d2z0ma2 first appeared in SCOPe 2.03
  
• d2z0ma2 appears in SCOPe 2.07