Lineage for d2z0ma2 (2z0m A:193-331)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872954Species Sulfolobus tokodaii [TaxId:111955] [225376] (1 PDB entry)
  8. 2872956Domain d2z0ma2: 2z0m A:193-331 [207764]
    automated match to d1hv8a2

Details for d2z0ma2

PDB Entry: 2z0m (more details), 1.9 Å

PDB Description: Crystal structure of hypothetical ATP-dependent RNA helicase from Sulfolobus tokodaii
PDB Compounds: (A:) 337aa long hypothetical ATP-dependent RNA helicase deaD

SCOPe Domain Sequences for d2z0ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0ma2 c.37.1.0 (A:193-331) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
glanvehkfvhvkddwrskvqalrenkdkgvivfvrtrnrvaklvrlfdnaielrgdlpq
svrnrnidafregeydmlittdvasrgldiplvekvinfdapqdlrtyihrigrtgrmgr
kgeaitfilneywlekevk

SCOPe Domain Coordinates for d2z0ma2:

Click to download the PDB-style file with coordinates for d2z0ma2.
(The format of our PDB-style files is described here.)

Timeline for d2z0ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z0ma1