| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Sulfolobus tokodaii [TaxId:111955] [225376] (1 PDB entry) |
| Domain d2z0ma1: 2z0m A:1-192 [207763] automated match to d1hv8a1 |
PDB Entry: 2z0m (more details), 1.9 Å
SCOPe Domain Sequences for d2z0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
mnekieqairemgfknftevqsktiplmlqgknvvvraktgsgktaayaipilelgmksl
vvtptreltrqvashirdigrymdtkvaevyggmpykaqinrvrnadivvatpgrlldlw
skgvidlssfeiviideadlmfemgfiddikiilaqtsnrkitglfsatipeeirkvvkd
fitnyeeieaci
Timeline for d2z0ma1: