Lineage for d2z01a1 (2z01 A:17-167)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658121Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1658193Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 1658194Protein automated matches [226901] (6 species)
    not a true protein
  7. 1658204Species Geobacillus kaustophilus [TaxId:1462] [225374] (1 PDB entry)
  8. 1658205Domain d2z01a1: 2z01 A:17-167 [207761]
    Other proteins in same PDB: d2z01a2
    automated match to d1clia1

Details for d2z01a1

PDB Entry: 2z01 (more details), 2.2 Å

PDB Description: crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus
PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d2z01a1:

Sequence, based on SEQRES records: (download)

>d2z01a1 d.79.4.0 (A:17-167) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
qavalmkehvqktmrpevlggiggfgglfdlsalgyrqpvlisgtdgvgtklklaflldr
hdtigidcvamcvndiivqgaeplffldyiacgkavpekiaaivkgvadgcveagcalig
getaempgmydedeydlagfavgvaekerli

Sequence, based on observed residues (ATOM records): (download)

>d2z01a1 d.79.4.0 (A:17-167) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
qavalmkehvqktmrpevlggglfdlsalgyrqpvlisgtdgvgtklklaflldrhdtig
idcvamcvndiivqgaeplffldyiacgkavpekiaaivkgvadgcveagcaliggetae
eydlagfavgvaekerli

SCOPe Domain Coordinates for d2z01a1:

Click to download the PDB-style file with coordinates for d2z01a1.
(The format of our PDB-style files is described here.)

Timeline for d2z01a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z01a2