Lineage for d2yznc2 (2yzn C:115-319)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585592Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2585593Protein automated matches [226904] (38 species)
    not a true protein
  7. 2585738Species Thermus thermophilus HB8 [TaxId:300852] [225373] (3 PDB entries)
  8. 2585744Domain d2yznc2: 2yzn C:115-319 [207760]
    Other proteins in same PDB: d2yzna1, d2yznb1, d2yznc1
    automated match to d1e4ea2
    complexed with anp

Details for d2yznc2

PDB Entry: 2yzn (more details), 2.6 Å

PDB Description: Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8.
PDB Compounds: (C:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2yznc2:

Sequence, based on SEQRES records: (download)

>d2yznc2 d.142.1.0 (C:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Sequence, based on observed residues (ATOM records): (download)

>d2yznc2 d.142.1.0 (C:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapgraellipapldp
gtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggv
aypellrrlvelalt

SCOPe Domain Coordinates for d2yznc2:

Click to download the PDB-style file with coordinates for d2yznc2.
(The format of our PDB-style files is described here.)

Timeline for d2yznc2: